PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00104618001
Common NameGSBRNA2T00104618001, LOC106415803
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 399aa    MW: 43966.6 Da    PI: 6.1562
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00104618001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1054.4e-33213267155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+rWtpeLHe+Fveav++LGGs++AtPk +l+ mkv+gLt++hvkSHLQkYR+
  GSBRNA2T00104618001 213 KARMRWTPELHEAFVEAVNSLGGSDRATPKGVLKKMKVEGLTIYHVKSHLQKYRT 267
                          68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.153210270IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-30211269IPR009057Homeodomain-like
SuperFamilySSF466895.2E-17212267IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-24213267IPR006447Myb domain, plants
PfamPF002491.1E-9215266IPR001005SANT/Myb domain
PfamPF143792.6E-24301344IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MEARPVQRSG SRELSNLART SSIPSTPNPS SAPEAAFMRP DHKPLGQQTY HLLSSSNGGS  60
VGHICSSSSS GFSTNLHYSS MVSHEKHYAA ASSNNDSSWC NGGFLDFPAD HQAVHNSSQI  120
EDGCIGIGAA FDDIQKPNDW QEWADHLITD EDPLLSTNWN DLLIDTSSNL DTKDQKSLQT  180
IPPQPQTVQQ QPSPSVSVEL RPVSTTSSNS NNKARMRWTP ELHEAFVEAV NSLGGSDRAT  240
PKGVLKKMKV EGLTIYHVKS HLQKYRTARY RPEPSESGSP EKKLTPLEHI TALDLKGGIG  300
ITEALRLQME VQKQLHEQLE IQRNLQLRIE EQGKYLQMMF EKQNSGLGKG TASTSDSPSK  360
SEQEDNKKTA DSEELAPEET RKCQEPESPQ PKRVKTDN*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.256500.0flower
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00104618001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013605899.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_013712050.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
SwissprotQ8GUN55e-76PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A078E8B10.0A0A078E8B1_BRANA; BnaC08g13160D protein
STRINGBra010355.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.10.0phosphate starvation response 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]